Антитела Anti-CD16 antibody, кроличьи, поликлональныеAnti-CD16 antibody
- Product nameAnti-CD16 antibody
See all CD16 primary antibodies
- Description
Rabbit polyclonal to CD16
- Tested applicationsFlow Cyt, IHC-P, WBmore details
- Species reactivity
Reacts with: Mouse, Rat, Human
- Immunogen
Synthetic peptide within Human CD16 aa 145-195 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence:
GKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGL A
Database link: P08637
- Positive control
- U937 cells; Human lung cancer, human glioma and mouse spleen tissues.
Associated products
- Positive Controls
- Related Products
Applications
Our Abpromise guarantee covers the use of ab203883 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
Flow Cyt |
|
1/20 - 1/100. |
IHC-P |
|
1/100 - 1/500.
When using a fluorescent probe the recommended dilution is 1/50 – 1/200.
|
WB |
|
1/100 - 1/1000. Predicted molecular weight: 29 kDa. |
Target
- FunctionReceptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
- Tissue specificityExpressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
- Sequence similaritiesContains 2 Ig-like C2-type (immunoglobulin-like) domains.
- Post-translational
modificationsGlycosylated. Contains high mannose- and complex-type oligosaccharides. The soluble form is produced by a proteolytic cleavage.
- Cellular localizationCell membrane. Secreted. Exists also as a soluble receptor.
- Information by UniProt
-
Database links
-
Alternative names
- CD 16 antibody
- CD 16a antibody
- CD16 antibody
see all
Anti-CD16 antibody images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD16 antibody (ab203883)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human glioma tissue labeling CD16 with ab203883 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
-
Flow Cytometry - Anti-CD16 antibody (ab203883)
U937 cells probed with ab203883 at a 1/100 for 40 minutes followed by incubation with Goat Anti-Rabbit IgG PE conjugated secondary at 1/100 (green) for 40 minutes compared to control cells (blue).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD16 antibody (ab203883)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung cancer tissue labeling CD16 with ab203883 at 1/200 dilution followed by Goat Anti-Rabbit IgG, Cy3 conjugated secondary antibody at 1/200 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD16 antibody (ab203883)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse spleen tissue labeling CD16 with ab203883 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.
References for Anti-CD16 antibody (ab203883)
Информация для заказаОбласть использования: | Производство: | Abcam | Метод: | | Объем: | 100 мкг | Кат. номер: | ab203883 | Цена (с НДС 20%): | по запросу | В корзину  | Наименование: Антитела Anti-CD16 antibody, кроличьи, поликлональные / Anti-CD16 antibody. Примечание: Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Дополнительная информация (на английском). |
|