Объем | 50 мкг |
Категория | Drug Target |
Подраздел | Immune Checkpoint |
Области исследований | Immunology |
Uniprot NO# | O95971 |
Наименование гена | CD160 |
Специфичность | Homo sapiens (Human) |
Источник | Mammalian cell |
Регион экспрессии | 27-159aa |
Последовательность | INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS |
Описание белка | Full Length of Mature Protein |
Информация о TAG | C-terminal 6xHis-tagged |
Мол. вес | 15.8 kDa |
Примечание | специальная цена до 30.06.2019! |
Биологическая активность | The ED50 as determined by its ability to bind Mouse TNFRSF14 in functional ELISA is less than 50 ug/ml. |
Очистка | Greater than 90% as determined by SDS-PAGE. |
Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
Буфер хранения | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Альтернативное имя / Синоним | CD160 Antigen; Natural Killer Cell Receptor BY55; CD160; BY55 |
Актуальность | CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in the spleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules. |
Функция | Receptor showing broad specificity for both classical and non-classical MHC class I molecules. |
Субклеточное расположение | Cell membrane, Lipid-anchor, GPI-anchor |
Тканевая специфичность | Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes. |
HGNC Database Link | ссылка |
UniGene Database Link | ссылка |
KEGG Database Link | ссылка |
STRING Database Link | ссылка |
OMIM Database Link | ссылка |
Ссылка на страницу на сайте производителя | ссылка |
| |