| Объем | 50 мкг |
| Категория | Drug Target |
| Подраздел | Immune Checkpoint |
| Области исследований | Immunology |
| Uniprot NO# | Q08722 |
| Наименование гена | CD47 |
| Специфичность | Homo sapiens (Human) |
| Источник | Mammalian cell |
| Регион экспрессии | 19-139aa |
| Последовательность | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
| Описание белка | Partial |
| Информация о TAG | C-terminal FC-tagged |
| Мол. вес | 40.8 kDa |
| Примечание | специальная цена до 30.06.2019! |
| Биологическая активность | The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 200 ng/ml. |
| Очистка | Greater than 95% as determined by SDS-PAGE. |
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
| Буфер хранения | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Альтернативное имя / Синоним | Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6 |
| Актуальность | CD47(Integrin-Associated Protein,IAP) is a 40 ‑ 60 kDa variably glycosylated atypical member of the immunoglobulin superfamily. The ubiquitously expressed CD47 binds to SIRP family members on macrophages, neutrophils, and T cells. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes. |
| Функция | Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. |
| Субклеточное расположение | Cell membrane, Multi-pass membrane protein |
| Тканевая специфичность | Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. |
| HGNC Database Link | ссылка |
| UniGene Database Link | ссылка |
| KEGG Database Link | ссылка |
| STRING Database Link | ссылка |
| OMIM Database Link | ссылка |
| Ссылка на страницу на сайте производителя | ссылка |
| | |
Наименование: Recombinant Human Leukocyte surface antigen CD47(CD47),partial.