| Объем | 50 мкг |
| Категория | Drug Target |
| Подраздел | FC Receptor |
| Области исследований | Immunology |
| Uniprot NO# | P08637 |
| Наименование гена | FCGR3A |
| Специфичность | Homo sapiens (Human) |
| Источник | Mammalian cell |
| Регион экспрессии | 17-208aa |
| Последовательность | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ |
| Описание белка | Extracellular Domain |
| Информация о TAG | C-terminal 6xHis-tagged |
| Мол. вес | 22.61 kDa |
| Примечание | специальная цена до 30.06.2019! |
| Биологическая активность | The ED50 as determined by its ability to bind Human IGHG1 in functional ELISA is less than 20 ug/ml. |
| Очистка | Greater than 95% as determined by SDS-PAGE. |
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
| Буфер хранения | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Альтернативное имя / Синоним | Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3 |
| Актуальность | Receptors for the Fc region of immunoglobin G (FcγR) are divided into three classes and FcγRIII is a multifunctional, low/intermediate affinity receptor. In humans, FcγRIII is expressed as two distinct forms (FcγRIIIA and FcγRIIIB) that are encoded by two different but highly homologous genes in a cell type-specific manner. FcγRIIIB is a low-affinity, GPI-linked receptor expressed by neutrophils and eosinophils, whereas FcγRIIIA is an intermediate affinity polypeptide-anchored transmembrane glycoprotein expressed by a subset of T lymphocytes, natural killer (NK) cells, monocytes, and macrophages. The FcγRIIIA receptor is involved in phagocytosis, secretion of enzymes, inflammatory mediators, antibody-dependent cellular cytotoxicity (ADCC), mast cell degranulation, and clearance of immune complexes. FcγRIIIA has an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain and delivers an activation signal in the immune responses. Aberrant expression or mutations in this gene is implicated in susceptibility to recurrent viral infections, systemic lupus erythematosus, and alloimmune neonatal neutropenia. In humans, it is a 50 -70 kD type I transmembrane activating receptor. The FcγRIIIA cDNA encodes 254 amino acid including a 16aa signal sequence, 191 amino acid ECD with two C2-type Ig-like domains, five potential N-glycosylation sites, a 22 amino acid transmembrane sequence and a 25 amino acid cytoplasmic domain. |
| Функция | Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. |
| Заболевание | Immunodeficiency 20 (IMD20) |
| Субклеточное расположение | Cell membrane, Single-pass type I membrane protein, Secreted |
| Тканевая специфичность | Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts. |
| Сигнальный путь | FcgammaR-mediatedphagocytosis |
| HGNC Database Link | ссылка |
| UniGene Database Link | ссылка |
| KEGG Database Link | ссылка |
| STRING Database Link | ссылка |
| OMIM Database Link | ссылка |
| Ссылка на страницу на сайте производителя | ссылка |
| | |
Наименование: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A(FCGR3A),partial.