| Объем | 10 мкг |
| Категория | Drug Target |
| Подраздел | Immune Checkpoint |
| Области исследований | Cancer |
| Uniprot NO# | P23510 |
| Наименование гена | TNFSF4 |
| Специфичность | Homo sapiens (Human) |
| Источник | Mammalian cell |
| Регион экспрессии | 51-183aa |
| Последовательность | QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
| Описание белка | Extracellular Domain |
| Информация о TAG | N-terminal 6xHis-tagged |
| Мол. вес | 16.3 kDa |
| Примечание | специальная цена до 30.06.2019! |
| Биологическая активность | The ED50 as determined by its ability to bind Human OX40 in functional ELISA is less than 20 ug/ml. |
| Очистка | Greater than 95% as determined by SDS-PAGE. |
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
| Буфер хранения | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Альтернативное имя / Синоним | Tumor necrosis factor ligand superfamily member 4;Glycoprotein Gp34;OX40 ligand;OX40L;TAX transcriptionally-activated glycoprotein 1;TNFSF4;CD252;TXGP1 |
| Актуальность | Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein.OX40L is expressed on the surface of activated B cells, T cells, dendritic cells and endothelial cells. OX40L binds to OX40 (CD134), a member of the TNF receptor superfamily that is expressed predominantly on activated CD4+ T cells. OX40-OX40L co-stimulates signal to promote the survival and proliferation of activated CD4+ T cells and prolong the immune response. It involved in T-cell proliferation and cytokine production. Additional, it has been found association with systemic lupus erythematosus, no association with occurrence of atherosclerosis. |
| Функция | Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. |
| Заболевание | Systemic lupus erythematosus (SLE) |
| Субклеточное расположение | Membrane, Single-pass type II membrane protein |
| Семейство белков | Tumor necrosis factor family |
| HGNC Database Link | ссылка |
| UniGene Database Link | ссылка |
| KEGG Database Link | ссылка |
| STRING Database Link | ссылка |
| OMIM Database Link | ссылка |
| Ссылка на страницу на сайте производителя | ссылка |
| | |
Наименование: Recombinant Human Tumor necrosis factor ligand superfamily member 4(TNFSF4),partial.