Объем | 50 мкг |
Категория | Drug Target |
Подраздел | Immune Checkpoint |
Области исследований | Cancer |
Uniprot NO# | P43489 |
Наименование гена | TNFRSF4 |
Специфичность | Homo sapiens (Human) |
Источник | Mammalian cell |
Регион экспрессии | 29-216aa |
Последовательность | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
Описание белка | Partial |
Информация о TAG | C-terminal FC-tagged |
Мол. вес | 46.8 kDa |
Примечание | специальная цена до 30.06.2019! |
Биологическая активность | The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 10 ug/ml. |
Очистка | Greater than 90% as determined by SDS-PAGE. |
Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
Буфер хранения | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Альтернативное имя / Синоним | Tumor necrosis factor receptor superfamily member 4;ACT35 antigen;OX40L receptor;TAX transcriptionally-activated glycoprotein 1 receptor;TNFRSF4;OX40;CD134;Txgp1 |
Актуальность | OX40,also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases. |
Функция | Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity. |
Заболевание | Immunodeficiency 16 (IMD16) |
Субклеточное расположение | Membrane, Single-pass type I membrane protein |
HGNC Database Link | ссылка |
UniGene Database Link | ссылка |
KEGG Database Link | ссылка |
STRING Database Link | ссылка |
OMIM Database Link | ссылка |
Ссылка на страницу на сайте производителя | ссылка |
| |