| Объем | 10 мкг |
| Категория | Drug Target |
| Подраздел | Immune Checkpoint |
| Области исследований | Immunology |
| Uniprot NO# | P25942 |
| Наименование гена | CD40 |
| Специфичность | Homo sapiens (Human) |
| Источник | Mammalian cell |
| Регион экспрессии | 21-193aa |
| Последовательность | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Описание белка | Extracellular Domain |
| Информация о TAG | C-terminal FC-tagged |
| Мол. вес | 46.3 kDa |
| Примечание | специальная цена до 30.06.2019! |
| Биологическая активность | The ED50 as determined by its ability to bind Human TNFSF5 in functional ELISA is less than 20 ug/ml. |
| Очистка | Greater than 95% as determined by SDS-PAGE. |
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
| Буфер хранения | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Альтернативное имя / Синоним | Tumor Necrosis Factor Receptor Superfamily member 5; B-Cell Surface Antigen CD40; Bp50; CD40L Receptor; CDw40; CD40; TNFRSF5 |
| Актуальность | CD40 is a Type I Transmembrane Glycoprotein that belongs to the TNF Receptor Superfamily. CD40 is expressed in B cells, follicular dendritic cells, dendritic cells, activated monocytes, macrophages, endothelial cells, vascular smooth muscle cells, and several tumor cell lines. The extracellular domain of CD40 is characterized by Cysteine rich repeat regions. Interaction of CD40 with its ligand (CD40L) leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Several different TRAF proteins (adaptor proteins) have been identified to serves as mediators of the signal transduction. CD40 plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. |
| Функция | Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. |
| Заболевание | Immunodeficiency with hyper-IgM 3 (HIGM3) |
| Субклеточное расположение | Isoform I: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform II: Secreted |
| Тканевая специфичность | B-cells and in primary carcinomas. |
| Сигнальный путь | NF-kappaBsignalingpathway |
| HGNC Database Link | ссылка |
| UniGene Database Link | ссылка |
| KEGG Database Link | ссылка |
| STRING Database Link | ссылка |
| OMIM Database Link | ссылка |
| Ссылка на страницу на сайте производителя | ссылка |
| | |
Наименование: Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40),partial.