| Объем | 10 мкг |
| Категория | Drug Target |
| Подраздел | Immune Checkpoint |
| Области исследований | Cancer |
| Uniprot NO# | Q80WM9 |
| Наименование гена | Tnfrsf14 |
| Специфичность | Mus musculus (Mouse) |
| Источник | Mammalian cell |
| Регион экспрессии | 39-207aa |
| Последовательность | QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV |
| Описание белка | Partial |
| Информация о TAG | C-terminal FC-tagged |
| Мол. вес | 45.6 kDa |
| Примечание | специальная цена до 30.06.2019! |
| Биологическая активность | The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml |
| Очистка | Greater than 95% as determined by SDS-PAGE. |
| Эндотоксин | Less than 1.0 EU/µg as determined by LAL method. |
| Буфер хранения | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Альтернативное имя / Синоним | Tnfrsf14; Herpesvirus entry mediator;HVEM; TR2;TNF receptor-like molecule;ATAR;another TRAF-associated receptor;Tumor necrosis factor receptor superfamily member 14 |
| Актуальность | Mouse Protein Tnfrsf14, is a type I transmembrane protein belonging to the TNF receptor superfamily. It is tumor necrosis factor receptor superfamily member 14 and expressed on the surface of T cells during the resting state. Interaction of HVEM with TNF family member LIGHT co-stimulates T cells and promotes inflammation. HVEM also triggers inhibitory signaling cascade in effector T (Teff) cells and regulatory T cells (Tregs) as a ligand of B and T lymphocyte attenuator. Tnfrsf14 is detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. It has demonstrated that HVEM Ig is able to exert a significant antiviral effect against HSV-1 infection in vivo. |
| Ссылка на страницу на сайте производителя | ссылка |
| | |
Наименование: Recombinant Mouse Tumor necrosis factor receptor superfamily member 14(Tnfrsf14),partial.