Recombinant Antileukoproteinase protein

Relevance: Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. May prevent elastase-mediated damage to oral and possibly other mucosal tissues.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Referrences: [1] "Molecular cloning and expression of cDNA for human antileukoprotease from cervix uterus." Heinzel R., Appelhans H., Gassen G., Seemueller U., Machleidt W., Fritz H., Steffens G. Eur. J. Biochem. 160:61-67(1986) [PubMed: 3533531] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Cervix. [2] "Isolation and sequence of a human gene encoding a potent inhibitor of leukocyte proteases." Stetler G., Brewer M.T., Thompson R.C. Nucleic Acids Res. 14:7883-7896(1986) [PubMed: 3640338] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. Tissue: Parotid gland. [3] "Cloning and characterization of SLPI from human intestinal epithelium." Si-Tahar M., Merlin D., Sitaraman S., Madara J.L. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: BLPI,HUSI-1,Mucus proteinase inhibitor,MPI,Protease inhibitor WAP4,Secretory leukocyte protease inhibitor,Seminal proteinase inhibitor,WAP four-disulfide core domain protein 4.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	200 мкг
	Кат. номер:	CSB-RP071544h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant Antileukoproteinase protein. Примечание: дополнительная информация (на английском языке).