Recombinant E.coli 30S ribosomal protein S13 protein
Relevance: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. Ref.11 In the E.coli 70S ribosome in the initiation state (Ref.14) was modeled to contact the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; bridge B1a is broken in the model with bound EF-G, while the protein-protein contacts between S13 and L5 in B1b change (Ref.14). The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states (Ref.15), contacting alternately S13 or S19. In the two 3.5 angstroms resolved ribosome structures (Ref.16) the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder. Ref.11 Contacts the tRNAs in the A and P sites. Ref.11 The C-terminal tail plays a role in the affinity of the 30S P site for different tRNAs. Ref.11
Product Info: GST-tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
Referrences: [1] "Nucleotide sequence of the alpha ribosomal protein operon of Escherichia coli." Bedwell D.M., Davis G.R., Gosink M., Post L.E., Nomura M., Kestler H., Zengel J.M., Lindahl L. Nucleic Acids Res. 13:3891-3903(1985) [PubMed: 2989779] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: K12. [2] "The complete genome sequence of Escherichia coli K-12." Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y. Science 277:1453-1474(1997) [PubMed: 9278503] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / MG1655 / ATCC 47076. [3] "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006) [PubMed: 16738553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / W3110 / ATCC 27325 / DSM 5911. [4] "Primary structure of protein S13 from the small subunit of Escherichia coli ribosomes." Lindemann H., Wittmann-Liebold B. Hoppe-Seyler's Z. Physiol. Chem. 358:843-863(1977) [PubMed: 330375] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-118. Strain: K. [5] "DNA sequence of the promoter region for the alpha ribosomal protein operon in Escherichia coli." Post L.E., Arfsten A.E., Davis G.R., Nomura M. J. Biol. Chem. 255:4653-4659(1980) [PubMed: 6154696] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-36.
Alias: .
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 50 мкг |
Кат. номер: | CSB-RP087344Ba |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant E.coli 30S ribosomal protein S13 protein. Примечание: дополнительная информация (на английском языке). |