Recombinant E.coli 30S ribosomal protein S21 protein
Relevance: Belongs to the ribosomal protein S21P family.
Product Info: GST-tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
Referrences: [1] "The operon that encodes the sigma subunit of RNA polymerase also encodes ribosomal protein S21 and DNA primase in E. coli K12." Burton Z.F., Gross C.A., Watanabe K.K., Burgess R.R. Cell 32:335-349(1983) [PubMed: 6186393] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: K12. [2] "Regulation of the rpsU-dnaG-rpoD macromolecular synthesis operon and the initiation of DNA replication in Escherichia coli K-12." Lupski J.R., Smiley B.L., Godson G.N. Mol. Gen. Genet. 189:48-57(1983) [PubMed: 6222240] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: K12. [3] "The complete genome sequence of Escherichia coli K-12." Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y. Science 277:1453-1474(1997) [PubMed: 9278503] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / MG1655 / ATCC 47076. [4] "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006) [PubMed: 16738553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / W3110 / ATCC 27325 / DSM 5911. [5] "Determination of the complete amino acid sequence of protein S21 from Escherichia coli ribosomes." Vandekerckhove J., Rombauts W., Peeters B., Wittmann-Liebold B. Hoppe-Seyler's Z. Physiol. Chem. 356:1955-1976(1975) [PubMed: 765257] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-71. Strain: K.
Alias: .
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP086544Ba |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant E.coli 30S ribosomal protein S21 protein. Примечание: дополнительная информация (на английском языке). |