Recombinant human Actin-related protein 2/3 complex subunit 2 protein
Relevance: Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride,20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDY
Referrences: [1] "The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly." Welch M.D., Depace A.H., Verma S., Iwamatsu A., Mitchison T.J. J. Cell Biol. 138:375-384(1997) [PubMed: 9230079] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], IDENTIFICATION IN THE ARP2/2 COMPLEX, SUBCELLULAR LOCATION. [2] "Generation of an integrated transcription map of the BRCA2 region on chromosome 13q12-q13." Couch F.J., Rommens J.M., Neuhausen S.L., Belanger C., Dumont M., Kenneth A., Bell R., Berry S., Bogden R., Cannon-Albright L., Farid L., Frye C., Hattier T., Janecki T., Jiang P., Kehrer R., Leblanc J.F., McArthur-Morrison J. , McSweeney D., Miki Y., Peng Y., Samson C., Schroeder M., Snyder S.C., Stringfellow M., Stroup C., Swedlund B., Swensen J., Teng D., Thakur S., Tran T., Tranchant M., Welver-Feldhaus J., Wong A.K.C., Shizuya H., Labrie F., Skolnick M.H., Goldgar D.E., Kamb A., Weber B.L., Tavtigian S.V., Simard J. Genomics 36:86-99(1996) [PubMed: 8812419] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Alias: Arp2/3 complex 34 kDa subunit,p34-ARC.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP033654h |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Actin-related protein 2/3 complex subunit 2 protein. Примечание: дополнительная информация (на английском языке). |