Recombinant human Agouti-related protein

Relevance: Plays a role in weight homeostasis. Plays a role in the central control of feeding. Reduces food intake. Inhibits cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Acts primarily on MC3R and MC4R. Has very low activity with MC5R By similarity.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Referrences: [1] "Hypothalamic expression of ART, a novel gene related to agouti, is up-regulated in obese and diabetic mutant mice." Shutter J.R., Graham M., Kinsey A.C., Scully S., Luethy R., Stark K.L. Genes Dev. 11:593-602(1997) [PubMed: 9119224] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Antagonism of central melanocortin receptors in vitro and in vivo by agouti-related protein." Ollmann M.M., Wilson B.D., Yang Y.K., Kerns J.A., Chen Y., Gantz I., Barsh G.S. Science 278:135-138(1997) [PubMed: 9311920] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Adrenal gland. [3] "The gene structure and minimal promoter of the human agouti related protein." Brown A.M., Mayfield D.K., Volaufova J., Argyropoulos G. Gene 277:231-238(2001) [PubMed: 11602360] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-67.
Alias: .

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	1 мг
	Кат. номер:	CSB-RP056944h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Agouti-related protein. Примечание: дополнительная информация (на английском языке).