Recombinant human Androgen receptor protein

Relevance: Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: LETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKI
Referrences: [1] "The human androgen receptor: complementary deoxyribonucleic acid cloning, sequence analysis and gene expression in prostate." Lubahn D.B., Joseph D.R., Sar M., Tan J., Higgs H.N., Larson R.E., French F.S., Wilson E.M. Mol. Endocrinol. 2:1265-1275(1988) [PubMed: 3216866] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). [2] "Structural analysis of complementary DNA and amino acid sequences of human and rat androgen receptors." Chang C., Kokontis J., Liao S. Proc. Natl. Acad. Sci. U.S.A. 85:7211-7215(1988) [PubMed: 3174628] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Prostate. [3] "Characterization and expression of a cDNA encoding the human androgen receptor." Tilley W.D., Marcelli M., Wilson J.D., McPhaul M.J. Proc. Natl. Acad. Sci. U.S.A. 86:327-331(1989) [PubMed: 2911578] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Prostate. [4] "Sequence of the intron/exon junctions of the coding region of the human androgen receptor gene and identification of a point mutation in a family with complete androgen insensitivity." Lubahn D.B., Brown T.R., Simental J.A., Higgs H.N., Migeon C.J., Wilson E.M., French F.S. Proc. Natl. Acad. Sci. U.S.A. 86:9534-9538(1989) [PubMed: 2594783] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT AIS MET-866.
Alias: Dihydrotestosterone receptor,Nuclear receptor subfamily 3 group C member 4.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	10 мкг
	Кат. номер:	CSB-RP059744h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Androgen receptor protein. Примечание: дополнительная информация (на английском языке).