Recombinant human Angiogenin protein

Relevance: May function as a tRNA-specific ribonuclease that abolishes protein synthesis by specifically hydrolyzing cellular tRNAs. Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP
Referrences: [1] "Sequence of the cDNA and gene for angiogenin, a human angiogenesis factor." Kurachi K., Davie E.W., Strydom D.J., Riordan J.F., Vallee B.L. Biochemistry 24:5494-5499(1985) [PubMed: 2866795] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "Diversifying selection of the tumor-growth promoter angiogenin in primate evolution." Zhang J., Rosenberg H.F. Mol. Biol. Evol. 19:438-445(2002) [PubMed: 11919285] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT GLU-84. [3] Li J., Wang H. Submitted (SEP-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: Ribonuclease 5 Short name=RNase 5.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	200 мкг
	Кат. номер:	CSB-RP057274h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Angiogenin protein. Примечание: дополнительная информация (на английском языке).