Recombinant human ATumor necrosis factor ligand superfamily member 9 protein

Relevance: Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Referrences: [1] "Molecular and biological characterization of human 4-1BB and its ligand." Alderson M.R., Smith C.A., Tough T.W., Davis-Smith T., Armitage R.J., Falk B., Roux E., Baker E., Sutherland G.R., Din W.S., Goodwin R.G. Eur. J. Immunol. 24:2219-2227(1994) [PubMed: 8088337] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Lung. [3] "The structure of the trimer of human 4-1BB ligand is unique among members of the tumor necrosis factor superfamily." Won E.Y., Cha K., Byun J.S., Kim D.U., Shin S., Ahn B., Kim Y.H., Rice A.J., Walz T., Kwon B.S., Cho H.S. J. Biol. Chem. 285:9202-9210(2010) [PubMed: 20032458] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 80-246, FUNCTION, SUBUNIT.
Alias: 4-1BB ligand,4-1BBL.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	10 мкг
	Кат. номер:	CSB-RP080474h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human ATumor necrosis factor ligand superfamily member 9 protein. Примечание: дополнительная информация (на английском языке).