Recombinant human Biogenesis of lysosome-related organelles complex 1 subunit 1 protein
Relevance: The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS-
Referrences: [1] "Molecular cloning of a novel human cDNA, RT14, containing a putative ORF highly conserved between human, fruit fly, and nematode." Watanabe T.K., Fujiwara T., Shinomiya H., Kuga Y., Hishigaki H., Nakamura Y., Hirai Y. DNA Res. 2:235-237(1995) [PubMed: 8770567] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Fetal brain. [2] "Isolation and characterization of a human cDNA clone (GCN5L1) homologous to GCN5, a yeast transcription activator." Inoue M., Isomura M., Ikegawa S., Fujiwara T., Shin S., Moriya H., Nakamura Y. Cytogenet. Cell Genet. 73:134-136(1996) [PubMed: 8646881] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 11-153 (ISOFORM 1).
Alias: BLOC-1 subunit 1,GCN5-like protein 1,Protein RT14.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP004954h |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Biogenesis of lysosome-related organelles complex 1 subunit 1 protein. Примечание: дополнительная информация (на английском языке). |