Recombinant human C-C motif chemokine 20 protein

Relevance: Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN
Referrences: [1] "Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta." Rossi D.L., Vicari A.P., Franz-Bacon K., McClanahan T.K., Zlotnik A. J. Immunol. 158:1033-1036(1997) [PubMed: 9013939] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). [2] "Molecular cloning of a novel human CC chemokine liver and activation-regulated chemokine (LARC) expressed in liver. Chemotactic activity for lymphocytes and gene localization on chromosome 2." Hieshima K., Imai T., Opdenakker G., van Damme J., Kusuda J., Tei H., Sakaki Y., Takatsuki K., Miura R., Yoshie O., Nomiyama H. J. Biol. Chem. 272:5846-5853(1997) [PubMed: 9038201] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF N-TERMINUS. Tissue: Liver. [3] "Cloning and characterization of Exodus, a novel beta-chemokine." Hromas R.A., Gray P.W., Chantry D., Godiska R., Krathwohl M., Fife K., Bell G.I., Takeda J., Aronica S., Gordon M., Cooper S., Broxmeyer H.E., Klemsz M.J. Blood 89:3315-3322(1997) [PubMed: 9129037] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Pancreas. [4] "Genomic organization of the CC chemokine mip-3alpha/CCL20/larc/ exodus/SCYA20, showing gene structure, splice variants, and chromosome localization." Nelson R.T., Boyd J., Gladue R.P., Paradis T., Thomas R., Cunningham A.C., Lira P., Brissette W.H., Hayes L., Hames L.M., Neote K.S., McColl S.R. Genomics 73:28-37(2001) [PubMed: 11352563] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Liver.
Alias: Beta-chemokine exodus-1,CC chemokine LARC,Liver and activation-regulated chemokine,Macrophage inflammatory protein 3 alpha,MIP-3-alpha,Small-inducible cytokine A20,,CCL20(1-67),CCL20(1-64),CCL20(2-70).

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	200 мкг
	Кат. номер:	CSB-RP058744h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human C-C motif chemokine 20 protein. Примечание: дополнительная информация (на английском языке).