Recombinant human C-C motif chemokine 5 protein
Relevance: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Referrences: [1] "A human T cell-specific molecule is a member of a new gene family." Schall T.J., Jongstra J., Dyer B.J., Jorgensen J., Clayberger C., Davis M.M., Krensky A.M. J. Immunol. 141:1018-1025(1988) [PubMed: 2456327] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, LEC, and RANTES." Nomiyama H., Fukuda S., Iio M., Tanase S., Miura R., Yoshie O. J. Interferon Cytokine Res. 19:227-234(1999) [PubMed: 10213461] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: EoCP,Eosinophil chemotactic cytokine,SIS-delta,Small-inducible cytokine A5,T cell-specific protein P228,TCP228,T-cell-specific protein RANTES.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP059544h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human C-C motif chemokine 5 protein. Примечание: дополнительная информация (на английском языке). |