Recombinant human C-C motif chemokine 5 protein
Relevance: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. Ref.3 Ref.8 Ref.10 Ref.11 Ref.12
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Referrences: [1] "A human T cell-specific molecule is a member of a new gene family." Schall T.J., Jongstra J., Dyer B.J., Jorgensen J., Clayberger C., Davis M.M., Krensky A.M. J. Immunol. 141:1018-1025(1988) [PubMed: 2456327] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, LEC, and RANTES." Nomiyama H., Fukuda S., Iio M., Tanase S., Miura R., Yoshie O. J. Interferon Cytokine Res. 19:227-234(1999) [PubMed: 10213461] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "A natural CCL5/RANTES variant antagonist for CCR1 and CCR3." Capoulade-Metay C., Ayouba A., Kfutwah A., Lole K., Petres S., Dudoit Y., Deterre P., Menu E., Barre-Sinoussi F., Debre P., Theodorou I. Immunogenetics 58:533-541(2006) [PubMed: 16791620] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, VARIANT PHE-24. Tissue: Blood. [4] Jang J.S., Kim B.E. Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Leukocyte. [5] "The complete sequence of human beta-chemokine RANTES mRNA." Zeng Q.P., Yang R.Y., Fu L.C. Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: EoCP,Eosinophil chemotactic cytokine,SIS-delta,Small-inducible cytokine A5,T cell-specific protein P228,TCP228,T-cell-specific protein RANTES.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 10 мкг |
Кат. номер: | CSB-RP059574h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human C-C motif chemokine 5 protein. Примечание: дополнительная информация (на английском языке). |