Recombinant human C-X-C motif chemokine 10 protein
Relevance: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Product Info: HIS-tagged
Source: E.coli derived
Purity: 90%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20110902090941_NjEw.png)
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Referrences: [1] "Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins." Luster A.D., Unkeless J.C., Ravetch J.V. Nature 315:672-676(1985) [PubMed: 3925348] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Prostate. [3] "Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8." Proost P., de Wolf-Peeters C., Conings R., Opdenakker G., Billiau A., van Damme J. J. Immunol. 150:1000-1010(1993) [PubMed: 8423327] [Abstract] Cited for: PROTEIN SEQUENCE OF 22-51. [4] "Human IP-9: a keratinocyte derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3)." Tensen C.P., Flier J., van der Raaij-Helmer E.M.H., Sampat-Sardjoepersad S., van der Schors R.C., Leurs R., Scheper R.J., Boorsma D.M., Willemze R. J. Invest. Dermatol. 112:716-722(1999) [PubMed: 10233762] [Abstract] Cited for: PROTEIN SEQUENCE OF 22-29. Tissue: Keratinocyte. [5] "Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity." Hensbergen P.J., van der Raaij-Helmer E.M.H., Dijkman R., van der Schors R.C., Werner-Felmayer G., Boorsma D.M., Scheper R.J., Willemze R., Tensen C.P. Eur. J. Biochem. 268:4992-4999(2001) [PubMed: 11559369] [Abstract] Cited for: PROTEIN SEQUENCE OF 22-27; 60-67 AND 79-98, MASS SPECTROMETRY, IDENTIFICATION OF CXCL10(1-73). Tissue: Foreskin keratinocyte.
Alias: 10 kDa interferon gamma-induced protein,Gamma-IP10,IP-10,Small-inducible cytokine B10.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP061074h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human C-X-C motif chemokine 10 protein. Примечание: дополнительная информация (на английском языке). |