Recombinant human C-X-C motif chemokine 5 protein

Relevance: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride,20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG
Referrences: [1] "Cloning of a full-length cDNA encoding the neutrophil-activating peptide ENA-78 from human platelets." Power C.A., Furness R.B., Brawand C., Wells T.N.C. Gene 151:333-334(1994) [PubMed: 7828901] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Cloning and characterization of the human neutrophil-activating peptide (ENA-78) gene." Chang M.S., McNinch J., Basu R., Simonet S. J. Biol. Chem. 269:25277-25282(1994) [PubMed: 7929219] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Characterization of the gene for human neutrophil-activating peptide 78 (ENA-78)." Corbett M.S., Schmitt I., Riess O., Walz A. Biochem. Biophys. Res. Commun. 205:612-617(1994) [PubMed: 7999089] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [4] "Localization of distal regulatory domains in the megakaryocyte-specific platelet basic protein/platelet factor 4 gene locus." Zhang C., Thornton M.A., Kowalska M.A., Sachis B.S., Feldman M., Poncz M., McKenzie S.E., Reilly M.P. Blood 98:610-617(2001) [PubMed: 11468158] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [5] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Kidney.
Alias: ENA-78(1-78),Epithelial-derived neutrophil-activating protein 78,Neutrophil-activating peptide ENA-78,Small-inducible cytokine B5,ENA-78(8-78),ENA-78(9-78).

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	50 мкг
	Кат. номер:	CSB-RP061554h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human C-X-C motif chemokine 5 protein. Примечание: дополнительная информация (на английском языке).