Recombinant human C-X-C motif chemokine 5 protein

Relevance: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Referrences: [1] "Cloning of a full-length cDNA encoding the neutrophil-activating peptide ENA-78 from human platelets." Power C.A., Furness R.B., Brawand C., Wells T.N.C. Gene 151:333-334(1994) [PubMed: 7828901] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Cloning and characterization of the human neutrophil-activating peptide (ENA-78) gene." Chang M.S., McNinch J., Basu R., Simonet S. J. Biol. Chem. 269:25277-25282(1994) [PubMed: 7929219] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Characterization of the gene for human neutrophil-activating peptide 78 (ENA-78)." Corbett M.S., Schmitt I., Riess O., Walz A. Biochem. Biophys. Res. Commun. 205:612-617(1994) [PubMed: 7999089] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: ENA-78(1-78),Epithelial-derived neutrophil-activating protein 78,Neutrophil-activating peptide ENA-78,Small-inducible cytokine B5.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	50 мкг
	Кат. номер:	CSB-RP061594h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human C-X-C motif chemokine 5 protein. Примечание: дополнительная информация (на английском языке).