Recombinant human Cytochrome c oxidase subunit 5A, mitochondrial protein
Relevance: This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Referrences: [1] "Subunit Va of human and bovine cytochrome c oxidase is highly conserved." Rizzuto R., Nakase H., Zeviani M., Dimauro S., Schon E.A. Gene 69:245-256(1988) [PubMed: 2853101] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Molecular evolution of the cytochrome c oxidase subunit 5A gene in primates." Uddin M., Opazo J.C., Wildman D.E., Sherwood C.C., Hof P.R., Goodman M., Grossman L.I. BMC Evol. Biol. 8:8-8(2008) [PubMed: 18197981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Alias: Cytochrome c oxidase polypeptide Va.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 500 мкг |
Кат. номер: | CSB-RP004144h |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Cytochrome c oxidase subunit 5A, mitochondrial protein. Примечание: дополнительная информация (на английском языке). |