Recombinant human Cytochrome c oxidase subunit 5B, mitochondrial protein
Relevance: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Referrences: [1] "Sequence of cDNAs encoding subunit Vb of human and bovine cytochrome c oxidase." Zeviani M., Sakoda S., Sherbany A., Nakase H., Rizzuto R., Samitt C.E., Dimauro S., Schon E.A. Gene 65:1-11(1988) [PubMed: 2840351] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Structure of the human cytochrome c oxidase subunit Vb gene and chromosomal mapping of the coding gene and of seven pseudogenes." Lomax M.I., Hsieh C.L., Darras B.T., Francke U. Genomics 10:1-9(1991) [PubMed: 1646156] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Skin. [4] "Phylogenetic footprinting of the human cytochrome c oxidase subunit VB promoter." Bachman N.J., Yang T.L., Dasen J.S., Ernst R.E., Lomax M.I. Arch. Biochem. Biophys. 333:152-162(1996) [PubMed: 8806766] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-37.
Alias: Cytochrome c oxidase polypeptide Vb.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP004044h |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Cytochrome c oxidase subunit 5B, mitochondrial protein. Примечание: дополнительная информация (на английском языке). |