Recombinant human DNA-directed RNA polymerases I, II, and III subunit RPABC2 protein

Relevance: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II, and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPB6 is part of the clamp element and togther with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG
Referrences: [1] "A 14.4 KDa acidic subunit of human RNA polymerase II with a putative leucine-zipper." Acker J., Wintzerith M., Vigneron M., Kedinger C. DNA Seq. 4:329-331(1994) [PubMed: 7803819] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "Genomic structure of the RNA polymerase II small subunit (hRPB14.4) locus (POLRF) and mapping to 22q13.1 by sequence identity." Pusch C., Wang Z., Roe B., Blin N. Genomics 34:440-442(1996) [PubMed: 8786150] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Alias: RNA polymerases I, II, and III subunit ABC2,DNA-directed RNA polymerase II subunit F,DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide,RPABC14.4,RPB14.4,RPB6 homolog,RPC15.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	10 мкг
	Кат. номер:	CSB-RP042644h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human DNA-directed RNA polymerases I, II, and III subunit RPABC2 protein. Примечание: дополнительная информация (на английском языке).