Recombinant human Dr1-associated corepressor protein
Relevance: The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Ref.1 Ref.2
Product Info: GST-tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE
Referrences: [1] "A mechanism for repression of class II gene transcription through specific binding of NC2 to TBP-promoter complexes via heterodimeric histone fold domains." Goppelt A.R., Stelzer G., Lottspeich F., Meisterernst M. EMBO J. 15:3105-3116(1996) [PubMed: 8670811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 2-31, FUNCTION, PHOSPHORYLATION, INTERACTION WITH DR1, TISSUE SPECIFICITY. Tissue: B-cell. [2] "Requirement of a corepressor for Dr1-mediated repression of transcription." Mermelstein F., Yeung K., Cao J., Inostroza J.A., Erdjument-Bromage H., Eagelson K., Landsman D., Levitt P., Tempst P., Reinberg D. Genes Dev. 10:1033-1048(1996) [PubMed: 8608938] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), PROTEIN SEQUENCE OF 20-26; 30-39 AND 72-91, FUNCTION, INTERACTION WITH DR1, PHOSPHORYLATION, TISSUE SPECIFICITY. Tissue: Cervix carcinoma. [3] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle. [4] "NC2alpha interacts with BTAF1 and stimulates its ATP-dependent association with TATA-binding protein." Klejman M.P., Pereira L.A., van Zeeburg H.J.T., Gilfillan S., Meisterernst M., Timmers H.T.M. Mol. Cell. Biol. 24:10072-10082(2004) [PubMed: 15509807] [Abstract] Cited for: INTERACTION WITH BTAF1. [5] "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Alias: Dr1-associated protein 1,Negative co-factor 2-alpha,NC2-alpha.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 10 мкг |
Кат. номер: | CSB-RP051444h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Dr1-associated corepressor protein. Примечание: дополнительная информация (на английском языке). |