ООО «Лабораторная Диагностика»
ООО «Лабораторная Диагностика» info@LD.ru    тел.: +7 495 369-20-43
 Главная   Новости   О компании  Каталог продукции и цены   Оформить заказ   Контакты 
 
  
Каталог продукции
  Рекомбинантные белки
  Cusabio
  OriGene
  Panomics
  ProSpec
  · Гормоны
  Евроген
  Гематология и трансфузиология
  Гемостаз  
  Иммуногистохимия
  Иммуноферментный анализ (ИФА)
  Иммунохимия  
  Клеточные технологии
  Клиническая биохимия
  Коагулометрия  
  Микробиология  
  Молекулярная диагностика
  Мультиплексный анализ  
  Оборудование для биохимии и
  молекулярной биологии
  Общелабораторное оборудование
  Онкология  
  Пищевая промышленность  
  Программное обеспечение  
  Проточная цитометрия
  ПЦР-лаборатория
  Репродуктивные технологии
  Секвенирование NGS
  Сортировка клеток
  Спектрофотометрия  
  Трансплантология
  Цитогенетическая диагностика
  Экспресс-лаборатория  

 
/ Каталог / Протеомика / Белки / Рекомбинантные белки / Рекомбинантные белки Cusabio

Recombinant human Dynein light chain 1, cytoplasmic protein

Relevance: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures. Ref.3 Ref.4 Ref.6 Ref.8 Binds and inhibits the catalytic activity of neuronal nitric oxide synthase. Ref.3 Ref.4 Ref.6 Ref.8 Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1. Ref.3 Ref.4 Ref.6 Ref.8 Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.
Product Info: GST tagged
Source: E.coli derived
Purity: 95%
Image:
 
 

Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Referrences: [1] "Cytoplasmic dynein (ddlc1) mutations cause morphogenetic defects and apoptotic cell death in Drosophila melanogaster." Dick T., Ray K., Salz H.K., Chia W. Mol. Cell. Biol. 16:1966-1977(1996) [PubMed: 8628263] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], SUBCELLULAR LOCATION, TISSUE SPECIFICITY. [2] "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. [3] "The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex." Puthalakath H., Huang D.C., O'Reilly L.A., King S.M., Strasser A. Mol. Cell 3:287-296(1999) [PubMed: 10198631] [Abstract] Cited for: FUNCTION IN REGULATION OF APOPTOSIS, INTERACTION WITH BCL2L11 AND BCL2.
Alias: 8 kDa dynein light chain,DLC8,Dynein light chain LC8-type 1,Protein inhibitor of neuronal nitric oxide synthase,PIN.

Информация для заказа

Область использования:Производство:Cusabio
Метод: 
Объем:1 мг 
Кат. номер:CSB-RP012854h
Цена (с НДС 20%):по запросуВ корзину
Recombinant human Dynein light chain 1, cytoplasmic proteinНаименование: Recombinant human Dynein light chain 1, cytoplasmic protein.
Примечание: дополнительная информация (на английском языке).
   
© ООО «Лабораторная Диагностика»
info@LD.ru   тел.: +7 495 369-20-43