Recombinant human Enhancer of rudimentary homolog protein

Relevance: May have a role in the cell cycle.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Referrences: [1] "Cloning and mapping of a novel human cDNA homologous to DROER, the enhancer of the Drosophila melanogaster rudimentary gene." Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y. Genomics 32:125-127(1996) [PubMed: 8786099] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY. [2] "The putative cell cycle gene, enhancer of rudimentary, encodes a highly conserved protein found in plants and animals." Gelsthorpe M., Pulumati M., McCallum C., Dang-Vu K., Tsubota S.I. Gene 186:189-195(1997) [PubMed: 9074495] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. [4] "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Alias: .

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	200 мкг
	Кат. номер:	CSB-RP027444h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Enhancer of rudimentary homolog protein. Примечание: дополнительная информация (на английском языке).