Recombinant human Eukaryotic translation initiation factor 1 protein

Relevance: Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Referrences: [1] "Expressed sequence tags identify a human isolog of the suil translation initiation factor." Fields C.A., Adams M.D. Biochem. Biophys. Res. Commun. 198:288-291(1994) [PubMed: 7904817] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Okadaic acid-responsive genes in malignant glioma cells identified by mRNA differential display." Singh S.K., Murray S.F., Chin L.S. Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Brain. [3] "Cloning and characterization of a human genotoxic and endoplasmic reticulum stress-inducible cDNA that encodes translation initiation factor 1 (eIF1(A121/SUI1))." Sheikh M.S., Fernandez-Salas E., Yu M., Hussain A., Dinman J.D., Peltz S.W., Huang Y., Fornace A.J. Jr. J. Biol. Chem. 274:16487-16493(1999) [PubMed: 10347211] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [4] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Eye and Lung. [5] "Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes." Mendell J.T., Medghalchi S.M., Lake R.G., Noensie E.N., Dietz H.C. Mol. Cell. Biol. 20:8944-8957(2000) [PubMed: 11073994] [Abstract] Cited for: INTERACTION WITH RENT2.
Alias: A121,Protein translation factor SUI1 homolog,Sui1iso1.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	50 мкг
	Кат. номер:	CSB-RP051144h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Eukaryotic translation initiation factor 1 protein. Примечание: дополнительная информация (на английском языке).