Recombinant human Gamma-aminobutyric acid receptor-associated protein protein
Relevance: May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Referrences: [1] "GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton." Wang H., Bedford F.K., Brandon N.J., Moss S.J., Olsen R.W. Nature 397:69-72(1999) [PubMed: 9892355] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY, INTERACTION WITH GABRG2 AND BETA-TUBULIN. Tissue: Brain. [2] "Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation." Okazaki N., Yan J., Yuasa S., Ueno T., Kominami E., Masuho Y., Koga H., Muramatsu M.-A. Brain Res. Mol. Brain Res. 85:1-12(2000) [PubMed: 11146101] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY, INTERACTION WITH ULK1. Tissue: Frontal cortex. [3] Iijima M., Mitsui Y. Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [4] Ye M., Fu G., Wu J., Zhou J., Zhang Q., Shen Y., Kan L., He K., Gu B., Chen S., Mao M., Chen Z. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: GABA(A) receptor-associated protein,MM46.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP054844h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human Gamma-aminobutyric acid receptor-associated protein protein. Примечание: дополнительная информация (на английском языке). |