Recombinant human Gamma-aminobutyric acid receptor-associated protein-like 2 protein
Relevance: Involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
Product Info: GST tagged
Source: E. coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Referrences: [1] "Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation." Okazaki N., Yan J., Yuasa S., Ueno T., Kominami E., Masuho Y., Koga H., Muramatsu M.-A. Brain Res. Mol. Brain Res. 85:1-12(2000) [PubMed: 11146101] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY, INTERACTION WITH ULK1. Tissue: Frontal cortex. [2] "Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein." Xin Y., Yu L., Chen Z., Zheng L., Fu Q., Jiang J., Zhang P., Gong R., Zhao S. Genomics 74:408-413(2001) [PubMed: 11414770] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY.
Alias: GABA(A) receptor-associated protein-like 2,Ganglioside expression factor 2,GEF-2,General protein transport factor p16,Golgi-associated ATPase enhancer of 16 kDa,GATE-16,MAP1 light chain 3-related protein.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 10 мкг |
Кат. номер: | CSB-RP034844h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Gamma-aminobutyric acid receptor-associated protein-like 2 protein. Примечание: дополнительная информация (на английском языке). |