Recombinant human Genome polyprotein
Relevance: Protein 3C is a cysteine protease that generates mature viral proteins from the precursor polyprotein. In addition to its proteolytic activity, it binds to viral RNA, and thus influences viral genome replication. RNA and substrate bind co-operatively to the protease.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ
Referrences: [1] "The complete nucleotide sequence of a common cold virus: human rhinovirus 14." Stanway G., Hughes P.J., Mountford R.C., Minor P.D., Almond J.W. Nucleic Acids Res. 12:7859-7875(1984) [PubMed: 6093056] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC RNA]. [2] "Role of maturation cleavage in infectivity of picornaviruses: activation of an infectosome." Lee W.M., Monroe S., Rueckert R.R. J. Virol. 67:2110-2122(1993) [PubMed: 8383233] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC RNA]. [3] "Molecular cloning and complete sequence determination of RNA genome of human rhinovirus type 14." Callahan P.L., Mizutani S., Colonno R.J. Proc. Natl. Acad. Sci. U.S.A. 82:732-736(1985) [PubMed: 2983312] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC RNA].
Alias: Protease 3C,P3C.
Информация для заказа