Recombinant human Glutathione S-transferase P protein
Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Referrences: [1] "Structure and expression of a human class pi glutathione S-transferase messenger RNA." Kano T., Sakai M., Muramatsu M. Cancer Res. 47:5626-5630(1987) [PubMed: 3664469] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "The structure of the human glutathione S-transferase pi gene." Cowell I.G., Dixon K.H., Pemble S.E., Ketterer B., Taylor J.B. Biochem. J. 255:79-83(1988) [PubMed: 3196325] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Structure of the human genomic glutathione S-transferase-pi gene." Morrow C.S., Cowan K.H., Goldsmith M.E. Gene 75:3-11(1989) [PubMed: 2542132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: GST class-pi,GSTP1-1.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP103344h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Glutathione S-transferase P protein. Примечание: дополнительная информация (на английском языке). |