Recombinant human GTPase HRas protein
Relevance: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
Referrences: [1] "Complete nucleotide sequences of the T24 human bladder carcinoma oncogene and its normal homologue." Capon D.J., Chen E.Y., Levinson A.D., Seeburg P.H., Goeddel D.V. Nature 302:33-37(1983) [PubMed: 6298635] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "Nucleotide sequence analysis of the T24 human bladder carcinoma oncogene." Reddy E.P. Science 220:1061-1063(1983) [PubMed: 6844927] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Molecular cloning and the total nucleotide sequence of the human c-Ha-ras-1 gene activated in a melanoma from a Japanese patient." Sekiya T., Fushimi M., Hori H., Hirohashi S., Nishimura S., Sugimura T. Proc. Natl. Acad. Sci. U.S.A. 81:4771-4775(1984) [PubMed: 6087347] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: H-Ras-1,Ha-Ras.
Информация для заказа