Recombinant human High mobility group protein B1 protein

Relevance: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE
Referrences: [1] "A human placental cDNA clone that encodes nonhistone chromosomal protein HMG-1." Wen L., Huang J.K., Johnson B.H., Reeck G.R. Nucleic Acids Res. 17:1197-1214(1989) [PubMed: 2922262] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "The active gene that encodes human high mobility group 1 protein (HMG1) contains introns and maps to chromosome 13." Ferrari S., Finelli P., Rocchi M., Bianchi M.E. Genomics 35:367-371(1996) [PubMed: 8661151] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Expression of high-mobility group-1 mRNA in human gastrointestinal adenocarcinoma and corresponding non-cancerous mucosa." Xiang Y.-Y., Wang D.-Y., Tanaka M., Suzuki M., Kiyokawa E., Igarashi H., Niato Y., Shen Q., Sugimura H. Int. J. Cancer 74:1-6(1997) [PubMed: 9036861] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANTS ARG-11; GLU-149 AND GLY-190.
Alias: High mobility group protein 1,HMG-1.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	1 мг
	Кат. номер:	CSB-RP016044h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human High mobility group protein B1 protein. Примечание: дополнительная информация (на английском языке).