Recombinant human Histone H3.3 protein
Relevance: Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Product Info: GST tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Referrences: [1] "Structure of a human histone cDNA: evidence that basally expressed histone genes have intervening sequences and encode polyadenylylated mRNAs." Wells D., Kedes L. Proc. Natl. Acad. Sci. U.S.A. 82:2834-2838(1985) [PubMed: 2859593] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (H3F3A). Tissue: Fibroblast. [2] "Unusual structure, evolutionary conservation of non-coding sequences and numerous pseudogenes characterize the human H3.3 histone multigene family." Wells D., Hoffman D., Kedes L. Nucleic Acids Res. 15:2871-2889(1987) [PubMed: 3031613] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (H3F3A). [3] "The human replacement histone H3.3B gene (H3F3B)." Albig W., Bramlage B., Gruber K., Klobeck H.-G., Kunz J., Doenecke D. Genomics 30:264-272(1995) [PubMed: 8586426] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (H3F3B). Tissue: Testis.
Alias: .
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 10 мкг |
Кат. номер: | CSB-RP014354h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Histone H3.3 protein. Примечание: дополнительная информация (на английском языке). |