Recombinant human HLA-DQB1 protein

Relevance: Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form an heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal miroenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
Product Info: His tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: RDSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESA
Referrences: [1] "Molecular analysis of human class II transplantation antigens and their genes." Larhammar D., Andersson G., Andersson M., Bill P., Boehme J., Claesson L., Denaro M., Emmoth E., Gustafsson K., Hammarling U., Heldin E., Hyldig-Nielsen J.-J., Lind P., Schenning L., Servenius B., Widmark E., Rask L., Peterson P.A. Hum. Immunol. 8:95-103(1983) [PubMed: 6415003] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ALLELE DQB1*02:01), NUCLEOTIDE SEQUENCE [MRNA] OF 33-261 (CLONE PII-BETA-2) (ALLELE DQB1*05:01). [2] "Complete amino acid sequence of an HLA-DR antigen-like beta chain as predicted from the nucleotide sequence: similarities with immunoglobulins and HLA-A, -B, and -C antigens." Larhammar D., Schenning L., Gustafsson K., Wiman K., Claesson L., Rask L., Peterson P.A. Proc. Natl. Acad. Sci. U.S.A. 79:3687-3691(1982) [PubMed: 6954511] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ALLELE DQB1*02:01). [3] "Exon-intron organization and complete nucleotide sequence of a human major histocompatibility antigen DC beta gene." Larhammar D., Hyldig-Nielsen J.-J., Servenius B., Andersson G., Rask L., Peterson P.A. Proc. Natl. Acad. Sci. U.S.A. 80:7313-7317(1983) [PubMed: 6316358] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ALLELE DQB1*03:02).
Alias: MHC class II antigen DQB1.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	1 мг
	Кат. номер:	CSB-RP148474h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human HLA-DQB1 protein. Примечание: дополнительная информация (на английском языке).