Recombinant human Interleukin-1 alpha protein

Relevance: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride,20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Referrences: [1] "Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs." March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D. Nature 315:641-647(1985) [PubMed: 2989698] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Complete nucleotide sequence of the gene for human interleukin 1 alpha." Furutani Y., Notake M., Fukui T., Ohue M., Nomura H., Yamada M., Nakamura S. Nucleic Acids Res. 14:3167-3179(1986) [PubMed: 3486405] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Cloning and characterization of the cDNAs for human and rabbit interleukin-1 precursor." Furutani Y., Notake M., Yamayoshi M., Yamagishi J., Nomura H., Ohue M., Furuta R., Fukui T., Yamada M., Nakamura S. Nucleic Acids Res. 13:5869-5882(1985) [PubMed: 2994016] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT SER-114. [4] "Cloning of the cDNA coding for human prointerleukin-1 alpha and prointerleukin-1 beta." Kotenko S.V., Bulenkov M.T., Veiko V.P., Epishin S.M., Lomakin I.B., Emel'Yanov A.V., Kozlov A.P., Konusova V.G., Kotov A.Y., Kurbatova T.V., Reshetnikov V.L., Simbirtsev A.S., Ketlinskii S.A., Vinetskii Y.P. Dokl. Akad. Nauk SSSR 309:1005-1008(1989) [PubMed: 2635664] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT SER-114.
Alias: Hematopoietin-1.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	500 мкг
	Кат. номер:	CSB-RP065654h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Interleukin-1 alpha protein. Примечание: дополнительная информация (на английском языке).