Recombinant human Interleukin-1 beta protein
Relevance: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: ELISA, Western blot
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Referrences: [1]"Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase." Mizutani H., Schechter N., Lazarus G., Black R.A., Kupper T.S. J. Exp. Med. 174:821-825(1991) [2]"Structural insights into the assembly and activation of IL-1beta with its receptors." Wang D., Zhang S., Li L., Liu X., Mei K., Wang X. Nat. Immunol. 11:905-911(2010)
Alias: IL-1 beta,Catabolin.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP065744h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Interleukin-1 beta protein. Примечание: дополнительная информация (на английском языке). |