ООО «Лабораторная Диагностика»
ООО «Лабораторная Диагностика» info@LD.ru    тел.: +7 495 369-20-43
 Главная   Новости   О компании  Каталог продукции и цены   Оформить заказ   Контакты 
 
  
Каталог продукции
  Рекомбинантные белки
  Cusabio
  OriGene
  Panomics
  ProSpec
  · Гормоны
  Евроген
  Гематология и трансфузиология
  Гемостаз  
  Иммуногистохимия
  Иммуноферментный анализ (ИФА)
  Иммунохимия  
  Клеточные технологии
  Клиническая биохимия
  Коагулометрия  
  Микробиология  
  Молекулярная диагностика
  Мультиплексный анализ  
  Оборудование для биохимии и
  молекулярной биологии
  Общелабораторное оборудование
  Онкология  
  Пищевая промышленность  
  Программное обеспечение  
  Проточная цитометрия
  ПЦР-лаборатория
  Репродуктивные технологии
  Секвенирование NGS
  Сортировка клеток
  Спектрофотометрия  
  Трансплантология
  Цитогенетическая диагностика
  Экспресс-лаборатория  

 
/ Каталог / Протеомика / Белки / Рекомбинантные белки / Рекомбинантные белки Cusabio

Recombinant human Interleukin-12 subunit beta protein

Relevance: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. Ref.12 Associates with IL23A to form the IL-23 interleukin, an heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to an heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Referrences: [1] "Coexpression of two distinct genes is required to generate secreted bioactive cytotoxic lymphocyte maturation factor." Gubler U., Chua A.O., Schoenhaut D.S., Dwyer C.M., McComas W., Motyka R., Nabavi N., Wolitzky A.G., Quinn P.M., Familletti P.C., Gately M.K. Proc. Natl. Acad. Sci. U.S.A. 88:4143-4147(1991) [PubMed: 1674604] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Cloning of cDNA for natural killer cell stimulatory factor, a heterodimeric cytokine with multiple biologic effects on T and natural killer cells." Wolf S.F., Temple P.A., Kobayashi M., Young D., Dicig M., Lowe L., Dzialo R., Fitz L., Ferenz C., Hewick R.M., Kelleher K., Herrmann S.H., Clark S.C., Azzoni L., Chan S.H., Trinchieri G., Perussia B. J. Immunol. 146:3074-3081(1991) [PubMed: 1673147] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "Complete primary structure, chromosomal localization, and definition of polymorphisms of the gene encoding the human interleukin 12 p40 subunit." Huang D., Cancilla M.R., Morahan G. Genes Immun. 1:515-520(2000) [PubMed: 11197695] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: Cytotoxic lymphocyte maturation factor 40 kDa subunit,CLMF p40,IL-12 subunit p40,NK cell stimulatory factor chain 2,NKSF2.

Информация для заказа

Область использования:Производство:Cusabio
Метод: 
Объем:500 мкг 
Кат. номер:CSB-RP066154h
Цена (с НДС 20%):по запросуВ корзину
Recombinant human Interleukin-12 subunit beta proteinНаименование: Recombinant human Interleukin-12 subunit beta protein.
Примечание: дополнительная информация (на английском языке).
   
© ООО «Лабораторная Диагностика»
info@LD.ru   тел.: +7 495 369-20-43