Recombinant human Interleukin-6 protein
Relevance: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
Product Info: HIS-tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Referrences: [1] "Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes to produce immunoglobulin." Hirano T., Yasukawa K., Harada H., Taga T., Watanabe Y., Matsuda T., Kashiwamura S., Nakajima K., Koyama K., Iwamatsu A., Tsunasawa S., Sakiyama F., Matsui H., Takahara Y., Taniguchi T., Kishimoto T. Nature 324:73-76(1986) [PubMed: 3491322] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE. [2] "Structure and expression of human B cell stimulatory factor-2 (BSF-2/IL-6) gene." Yasukawa K., Hirano T., Watanabe Y., Muratani K., Matsuda T., Nakai S., Kishimoto T. EMBO J. 6:2939-2945(1987) [PubMed: 3500852] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Anti-beta-interferon antibodies inhibit the increased expression of HLA-B7 mRNA in tumor necrosis factor-treated human fibroblasts: structural studies of the beta 2 interferon involved." May L.T., Helfgott D.C., Sehgal P.B. Proc. Natl. Acad. Sci. U.S.A. 83:8957-8961(1986) [PubMed: 3538015] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [4] "Structure and expression of cDNA and genes for human interferon-beta-2, a distinct species inducible by growth-stimulatory cytokines." Zilberstein A., Ruggieri R., Korn J.H., Revel M. EMBO J. 5:2529-2537(1986) [PubMed: 3023045] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [5] "Molecular cloning and expression of hybridoma growth factor in Escherichia coli." Brakenhoff J.P.J., de Groot E.R., Evers R.F., Pannekoek H., Aarden L.A. J. Immunol. 139:4116-4121(1987) [PubMed: 3320204] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: B-cell stimulatory factor 2,BSF-2,CTL differentiation factor,CDF,Hybridoma growth factor,Interferon beta-2,IFN-beta-2.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP067574h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Interleukin-6 protein. Примечание: дополнительная информация (на английском языке). |