Recombinant human Interleukin-8 protein
Relevance: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: ELISA, Western blot
Storage Buffer: 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin, PH 8.0; 200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Referrences: [1]"The neutrophil-activating proteins interleukin 8 and beta-thromboglobulin: in vitro and in vivo comparison of NH2-terminally processed forms." van Damme J., Rampart M., Coning R., Decock B., van Osselaer N., Willems J., Billiau A. Eur. J. Immunol. 20:2113-2118(1990) [2]"Biochemical and biological characterization of NAP-1/IL-8-related cytokines in lesional psoriatic scale." Schroeder J.-M. Adv. Exp. Med. Biol. 305:97-107(1991)
Alias: IL-8,C-X-C motif chemokine 8,Emoctakin,Granulocyte chemotactic protein 1,GCP-1,Monocyte-derived neutrophil chemotactic factor,MDNCF,Monocyte-derived neutrophil-activating peptide,MONAP,Neutrophil-activating protein 1,NAP-1,Protein 3-10C,T-cell chemotactic factor.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP083274h |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Interleukin-8 protein. Примечание: дополнительная информация (на английском языке). |