Recombinant human Macrophage migration inhibitory factor protein
Relevance: Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Referrences: [1] "Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor." Weiser W.Y., Temple P.A., Witek-Giannotti J.S., Remold H.G., Clark S.C., David J.R. Proc. Natl. Acad. Sci. U.S.A. 86:7522-7526(1989) [PubMed: 2552447] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], INDUCTION, SUBCELLULAR LOCATION. [2] "Molecular cloning and functional expression of a cDNA encoding glycosylation-inhibiting factor." Mikayama T., Nakano T., Gomi H., Nakagawa Y., Liu Y.C., Iwamatsu A., Weiser W.Y., Ishizaka K., Sato M., Ishii Y. Proc. Natl. Acad. Sci. U.S.A. 90:10056-10060(1993) [PubMed: 8234256] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], SUBCELLULAR LOCATION. [3] "Purification, bioactivity, and secondary structure analysis of mouse and human macrophage migration inhibitory factor (MIF)." Bernhagen J., Mitchell R.A., Calandra T., Voelter W., Cerami A., Bucala R. Biochemistry 33:14144-14155(1994) [PubMed: 7947826] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [4] "Cloning the human gene for macrophage migration inhibitory factor (MIF)." Paralkar V., Wistow G.J. Genomics 19:48-51(1994) [PubMed: 8188240] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [5] "The effect of macrophage migration inhibitory factor in the atherogenesis process." Shan Z.X., Yu X.Y., Lin S.G., Lin Q.X., Fu Y.H., Tan H.H. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: Glycosylation-inhibiting factor,GIF,L-dopachrome isomerase,L-dopachrome tautomerase,Phenylpyruvate tautomerase.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP068644h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Macrophage migration inhibitory factor protein. Примечание: дополнительная информация (на английском языке). |