Recombinant human Metalloproteinase inhibitor 2 protein
Relevance: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20110803140822_NzQw.png)
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Referrences: [1] "Tissue inhibitor of metalloproteinases-2 (TIMP-2) mRNA expression in tumor cell lines and human tumor tissues." Stetler-Stevenson W.G., Brown P.D., Onisto M., Levy A.T., Liotta L.A. J. Biol. Chem. 265:13933-13938(1990) [PubMed: 2380196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], INDUCTION. [2] "cDNA cloning and expression of a metalloproteinase inhibitor related to tissue inhibitor of metalloproteinases." Boone T.C., Johnson M.J., de Clerck Y.A., Langley K.E. Proc. Natl. Acad. Sci. U.S.A. 87:2800-2804(1990) [PubMed: 2157214] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: CSC-21K,Tissue inhibitor of metalloproteinases 2,TIMP-2.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 50 мкг |
Кат. номер: | CSB-RP074054h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human Metalloproteinase inhibitor 2 protein. Примечание: дополнительная информация (на английском языке). |