Recombinant human Mitochondrial 2-oxoglutarate/malate carrier protein
Relevance: Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: DLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYT
Referrences: [1] "Sequences of the human and bovine genes for the mitochondrial 2-oxoglutarate carrier." Iacobazzi V., Palmieri F., Runswick M.J., Walker J.E. DNA Seq. 3:79-88(1992) [PubMed: 1457818] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] Yu W., Gibbs R.A. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Brain. [3] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Muscle and Uterus.
Alias: Solute carrier family 25 member 11.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP021844h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Mitochondrial 2-oxoglutarate/malate carrier protein. Примечание: дополнительная информация (на английском языке). |