Recombinant human Mucin-16 protein
Relevance: Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: TTAMGYHLKTLTLNFTISNLQYSPDMGKGSATFNSTEGVLQHLLRPLFQKSSMGPFYLGCQLISLRPEKDGAATGVDTTCTYHPDPVGPGLDIQQLYWELSQLTHGVTQLGFYVLDRDSLFINGYAPQNLSIRGEYQINFHIVNWNLSNPDPTSSEYITLLRDIQDKVTTLYKGSQLHDTFRFCLVTNLTMDSVLVTVKALFSSNLDPSLVEQVFLDKTLNASFHWLGSTYQLVDIHVTEMESSVYQPTSSSSTQHFYLNFT
Referrences: [1] "The CA 125 gene: a newly discovered extension of the glycosylated N-terminal domain doubles the size of this extracellular superstructure."O’Brien T.J., Beard J.B., Underwood L.J., Shigemasa K. Tumor Biol. 23:154-169(2002) [PubMed: 12218296] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-10431, SEQUENCE REVISION TO N-TERMINUS, TISSUE SPECIFICITY, INDUCTION. [2] "The CA 125 gene: an extracellular superstructure dominated by repeat sequences."O’Brien T.J., Beard J.B., Underwood L.J., Dennis R.A., Santin A.D., York L. Tumor Biol. 22:348-366(2001) [PubMed: 11786729] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 10432-22152. [3] "Molecular cloning of the CA125 ovarian cancer antigen: identification as a new mucin, MUC16." Yin B.W.T., Lloyd K.O.J. Biol. Chem. 276:27371-27375(2001) [PubMed: 11369781] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8297-22152, PROTEIN SEQUENCE OF 21360-21365 AND 21983-21995, TISSUE SPECIFICITY.
Alias: MUC-16 MUC16 Ovarian cancer-related tumor marker CA125 CA-125.
Информация для заказа