Recombinant human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 protein
Relevance: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride,20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Referrences: [1] "Isolation, mapping, and genomic structure of an X-linked gene for a subunit of human mitochondrial complex I." Zhuchenko O., Wehnert M., Bailey J., Sun Z.S., Lee C.C. Genomics 37:281-288(1996) [PubMed: 8938439] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Identification of a new member (ZNF183) of the Ring finger gene family in Xq24-25." Frattini A., Faranda S., Bagnasco L., Patrosso C., Nulli P., Zucchi I., Vezzoni P. Gene 192:291-298(1997) [PubMed: 9224902] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Liver. [3] "hMWFE gene -- component of human mitochondrial complex I." Zhuchenko O.P., Wehnert M., Bailey J., Sun Z.S., Lee C.C. Submitted (APR-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: Complex I-MWFE,CI-MWFE,NADH-ubiquinone oxidoreductase MWFE subunit.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP016654h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 protein. Примечание: дополнительная информация (на английском языке). |