Recombinant human Peptidyl-prolyl cis-trans isomerase A protein
Relevance: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Product Info: No tag
Source: E.coli derived
Purity: 90%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20120322090344_Mzg=.jpg)
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MVNTVDIAVDGGRVSADKVKTANRASTGKGGYKGSCHRIIGMCGGDTRHNGTGGKSIYGKDNIKHTGGISMANAGNTNGSICTAKTWDGKHVVGKVKGMNIVAMRGSRNGKTSKKITIADCG
Referrences: [1] "Complementary DNA for human T-cell cyclophilin." Haendler B., Hofer-Warbinek R., Hofer E. EMBO J. 6:947-950(1987) [PubMed: 3297675] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Leukemic T-cell. [2] "Characterization of the human cyclophilin gene and of related processed pseudogenes." Haendler B., Hofer E. Eur. J. Biochem. 190:477-482(1990) [PubMed: 2197089] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Alias: Cyclophilin A,Cyclosporin A-binding protein,Rotamase A.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 50 мкг |
Кат. номер: | CSB-RP078124h |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant human Peptidyl-prolyl cis-trans isomerase A protein. Примечание: дополнительная информация (на английском языке). |