Recombinant human Peptidyl-prolyl cis-trans isomerase FKBP1A protein
Relevance: May play a role in modulation of ryanodine receptor isoform-1 (RYR-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. There are four molecules of FKBP12 per skeletal muscle RYR. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride,20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE
Referrences: [1] "Complementary DNA encoding the human T-cell FK506-binding protein, a peptidylprolyl cis-trans isomerase distinct from cyclophilin." Maki N., Sekiguchi F., Nishimaki J., Miwa K., Hayano T., Takahashi N., Suzuki M. Proc. Natl. Acad. Sci. U.S.A. 87:5440-5443(1990) [PubMed: 1695378] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Molecular cloning and overexpression of the human FK506-binding protein FKBP." Standaert R.F., Galat A., Verdine G.L., Schreiber S.L. Nature 346:671-674(1990) [PubMed: 1696686] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Exon organization of the human FKBP-12 gene: correlation with structural and functional protein domains." Dilella A.G., Craig R.J. Biochemistry 30:8512-8517(1991) [PubMed: 1716149] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: PPIase FKBP1A,12 kDa FK506-binding protein,12 kDa FKBP,FKBP-12,FK506-binding protein 1A,FKBP-1A,Immunophilin FKBP12,Rotamase.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 10 мкг |
Кат. номер: | CSB-RP023254h |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Peptidyl-prolyl cis-trans isomerase FKBP1A protein. Примечание: дополнительная информация (на английском языке). |